7BZZA

Crystal structure of the srcr domain of mouse scara5
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
MDFTMIRLVNGSGPHQGRVEVFHDRRWGTVCDDGWDKKDGDVVCRMLGFHGVEEVYRTARFGQGTGRIWMDDVNCKGTESSIFHCQFSKWGVTNCGHAEDAGVTCTSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Scavenger receptor class A member 5
publication title Crystal structure of the SRCR domain of mouse SCARA5
rcsb
source organism Mus musculus
total genus 27
structure length 109
sequence length 109
chains with identical sequence D
ec nomenclature
pdb deposition date 2020-04-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...