7C8FA

Structure of alginate lyase alyc3 in complex with dimannuronate(2m)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
266
structure length
266
Chain Sequence
NVQFSNQDGALGEPANYTQFQHVLTESELQISDAEGKKGNKEYFALDGNFTGIVNQYFYVDKKSEALVFKMKNDHLRNEVRVHKNFRTDLPNKLYTLSAEVEIIDPVASMKNSNSKQNEITFLQVANKGLDNQGTHNVPHPLLRVVWKEDANSVKGHFWAMVKNNAVICKGSFGKKNKDKEMCKADVAYKKYDLGKAPLNKATAFDITVGNKQLIIDVDGKRLVEHDIDYWRHLLSYFKAGVANQFTNGMSEAHFNKLEYKALETK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords H127A/Y244A mutant of alginate lyase AlyC3 in complex with d
publication title Structural and molecular basis for the substrate positioning mechanism of a new PL7 subfamily alginate lyase from the Arctic.
pubmed doi rcsb
source organism Psychromonas sp.
total genus 73
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature
pdb deposition date 2020-05-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...