7C9RC

Structure of photosynthetic lh1-rc super-complex of thiorhodovibrio strain 970
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
311
structure length
311
Chain Sequence
CDFPPQDVVQTGYRGLGMQQNYNPKLLQKVIDATQVPDAIPAATPGGALAKDVYKNVQVLGDLSVNEFNRTMVALTTWVAPNEGCTYCHEGTNWESDGVYTKIASRRMLEMTRDTNSNWTGHVADTGVTCYTCHRGKPVPEHVWTTDPGPDIPSVFPSNGQNTIGYNVAYTALPFDPFTPFLLGENEIRVSGNTDLRNTNRKSIKQAEWTFALMTHFSEALGVNCTYCHNSRAFMDWNQSTPKRVPAWHAIRNVRDINIQYVEPLGEVLPASRKGPLGDPFKVNCLTCHQGAYKPLFGVPMAKDYPALYET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosynthetic reaction center cytochrome c subunit
publication title Cryo-EM Structure of a Ca2+-Bound Photosynthetic LH1-RC Complex Containing Multiple Polypeptides
doi rcsb
total genus 67
structure length 311
sequence length 311
ec nomenclature
pdb deposition date 2020-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02276 CytoC_RC Photosynthetic reaction centre cytochrome C subunit
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...