7CNVA

Crystal structure of iscu h106c variant
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
132
structure length
132
Chain Sequence
MIQQTGYSKKVMEHFMNPRNVGVIDDPDGYGKVGNPVCGDLMEIFIKVGDEKIEDIKFRTFGCGAAIATSSMITEMARGKSLEEAMRITRNDVADALDGLPPQKMCCSNLAADALHAAINDYLSKKQKHLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Nitrogen-fixing NifU domain protein
publication title [2Fe-2S] clusters-assembled dimeric structures of IscU iron-sulfur scaffold
rcsb
source organism Methanothrix thermoacetophila
total genus 42
structure length 132
sequence length 132
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2020-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01592 NifU_N NifU-like N terminal domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...