7CNYB

Crystal structure of 8pe bound psd from e. coli (2.12 a)
Total Genus 0
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
0
sequence length
33
structure length
33
Chain Sequence
b'TVINLFAPGKVNLVEQLESLSVTKIGQPLAVST'

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phosphatidylserine decarboxylase beta chain
publication title Structural insights into phosphatidylethanolamine formation in bacterial membrane biogenesis.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
structure length 33
sequence length 33
chains with identical sequence D
ec nomenclature
pdb deposition date 2020-08-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...