7CPMA

Crystal structure of dodecaprenyl diphosphate synthase from thermobifida fusca
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
244
structure length
244
Chain Sequence
EPIPPQPHPSGARPPQLPRELIPRHVAIVMDGNGRWAKQRGLPRTEGHKAGESSLFDVIEGALELGVPYLSAYAFSTENWKRSPDEVRFLMGFNRDVIRRRRDELHARGVRVRWAGRPGRLWKSVIKELTEAEELTKHNTKLTLQFCVNYGGRAEIADAAAALARDVAAGRLSPNRVTEATLARYLYHPDIPDVDLFIRSSGEQRLSNFLLWQSSYAEFVFLDTLWPDFDRRHFWQACEIYARR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Trans,polycis-polyprenyl diphosphate synthase ((2Z,6E)-farne
publication title Crystal structure of Thermobifida fusca cis-prenyltransferase reveals the dynamic nature of its RXG motif-mediated inter-subunit interactions critical for its catalytic activity.
pubmed doi rcsb
source organism Thermobifida fusca (strain yx)
total genus 85
structure length 244
sequence length 244
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2020-08-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...