The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
27
|
sequence length |
120
|
structure length |
120
|
Chain Sequence |
PGILGTWYNQLGSVMVVTRAANGGFVGTYESAVGNAEKRYVMTGRYDSAPADGTGTAVGWTVAYRNAHRNAHSVATWSGQYVGGSQERIVTQWLLSYGTTPADQWKSTFLGHDEFTRVKP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Antimicrobial protein
|
| molecule keywords |
Mature Streptoavidin-C1
|
| publication title |
Insights into the structure of mature streptavidin C1 from Streptomyces cinnamonensis reveal the self-binding of the extension C-terminal peptide to biotin-binding sites.
pubmed doi rcsb |
| source organism |
Streptomyces sp. h036
|
| total genus |
27
|
| structure length |
120
|
| sequence length |
120
|
| ec nomenclature | |
| pdb deposition date | 2020-08-08 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01382 | Avidin | Avidin family |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
