7CROI

Nsd2 bearing e1099k/t1150a dual mutation in complex with 187-bp ncp
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
219
structure length
219
Chain Sequence
KPPPYKHIKVNKPYGKVQIYTADISEIPKCNCKPTDENPCGFDSECLNRMLMFECHPQVCPAGEFCQNQCFTKRQYPETKIIKTDGKGWGLVAKRDIRKGEFVNEYVGELIDKEECMARIKHAHENDITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCEALKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSGFLGDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation
molecule keywords Histone H3
publication title Molecular basis of nucleosomal H3K36 methylation by NSD methyltransferases.
pubmed doi rcsb
source organism Xenopus laevis
total genus 19
structure length 219
sequence length 219
ec nomenclature ec 2.1.1.356: [Histone H3]-lysine(27) N-trimethyltransferase.
pdb deposition date 2020-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00855 PWWP PWWP domain
I PF00856 SET SET domain
I PF17907 AWS AWS domain
I PF17982 C5HCH NSD Cys-His rich domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...