7CUJA

Crystal structure of fission yeast ccq1 and tpz1
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
308
structure length
258
Chain Sequence
SVLDIGLPMSALQRKMMHRLVQYFAFCIDHFCTGPSDSRIQEKIRLFIQSAHNIAKHPSLYDTEVRNFSSYAENSSKFLFLQELFKNLSPSYSKTFFLFISNQFLANTLTQWLKSQNIDAELWAEHPAIWICVSKKAPSASHFLQSCPDLSATIFYDIEAYMSVTSSLPSIQSLVLRLIHLGSIEHAIKCFQSSYNASFLVNIVGVVATLSSSESHSSITEKTRDIAKNVATWLKNGENFSSWPLPPLMDLASLSVAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Coiled-coil quantitatively-enriched protein 1
publication title Structural Insights into Fission Yeast Telomeric Overhang Binding Pot1-Tpz1-Ccq1 Complex
rcsb
source organism Schizosaccharomyces pombe (strain 972 / atcc 24843)
total genus 89
structure length 258
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2020-08-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...