7CUJC

Crystal structure of fission yeast ccq1 and tpz1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
38
structure length
38
Chain Sequence
LEYKRKPIPDYDFMKGLETTLQELYVEHQSKKRRLELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Coiled-coil quantitatively-enriched protein 1
publication title Structural Insights into Fission Yeast Telomeric Overhang Binding Pot1-Tpz1-Ccq1 Complex
rcsb
source organism Schizosaccharomyces pombe (strain 972 / atcc 24843)
total genus 13
structure length 38
sequence length 38
chains with identical sequence D
ec nomenclature
pdb deposition date 2020-08-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...