7CW1A

Crystal structure of a biodegradable plastic-degrading cutinase-like enzyme from the phyllosphere yeast, pseudozyma antarctica, solved by getting the phase from anomalous scattering of uncovalently coordinated arsenic (cacodylate).
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
197
structure length
197
Chain Sequence
GCSSYVIINTRGTSEPQGPSVGFRTMNTRIRSAVSGGSEYDTVYPAGIDQNSAQGTANIVAQVKAGLARNPNTCFLLEGYSQGAAATCNALPQLTGAAFDAVKGVILIGNPEHKPNLACNVDGNGGKTTFSARGISAAFTQGVPSNWVSKTLDICIYGDGVCDVSSGFGITPQHLTYGYNTNVQTMGANFGIKALQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cutinase-like enzyme
publication title Crystal structure of a biodegradable plastic-degrading cutinase-like enzyme from the phyllosphere yeast, Pseudozyma antarctica, solved by getting the phase from anomalous scattering of uncovalently coordinated arsenic (cacodylate).
rcsb
total genus 73
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2020-08-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...