7CX7A

Crystal structure of arabinose isomerase from hybrid ai8
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
495
structure length
495
Chain Sequence
LSLRPYEFWFVTGSQHLYGEEALKQVEEHSRIMVNEWNRDSVFPFPFVFKSVVTTPEEIRRVCLEANASEQCAGVVTWMHTFSPAKMWIGGLLELRKPLLHLHTQFNRDIPWDSIDMDFMNLNQSAHGDREFGFMVTRLGMPRKVIVGHWQDAEVARRVRGWAMTAVAAAVSRGLKVARFGDNMRQVAVTEGDKVEAEARFGWSVNGYGVGDLAERVRAVSEAEIDRLIDEYQSLYEFAPGCEKGGPLHDGVREQARIELGLRSFLEEGGFEAFTTTFEDLHGMKQLPGLAVQRLMAEGYGFGGEGDWKTAALVRLMKVMADGKGTSFMEDYTYHFEPGNEMILGAHMLEVCPTIAATRPRIEVHPLSIGGKEDPARLVFDGGEGAAVNASLIDLGHRFRLIVNEVDAVKPEHDMPKLPVARILWKPRPSLRDSAEAWILAGGAHHTCFSFAVTTEQLQDFAEMAGIECVVINEHTSVSSFKNELKWNEVFWRGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase
molecule keywords L-arabinose isomerase
publication title Crystal structure of Arabinose isomerase from hyper thermophilic bacterium Thermotoga maritima (TMAI) wt
rcsb
source organism Geobacillus kaustophilus (strain hta426)
total genus 174
structure length 495
sequence length 495
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.3.1.4: L-arabinose isomerase.
pdb deposition date 2020-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02610 Arabinose_Isome L-arabinose isomerase
A PF11762 Arabinose_Iso_C L-arabinose isomerase C-terminal domain
A PF02610 Arabinose_Isome L-arabinose isomerase
A PF11762 Arabinose_Iso_C L-arabinose isomerase C-terminal domain
A PF02610 Arabinose_Isome L-arabinose isomerase
A PF11762 Arabinose_Iso_C L-arabinose isomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...