7D39A

Flr-apo
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
308
structure length
288
Chain Sequence
MKILGISGGMRNGSNDGMCIEALMGAKEMGAEVEFIQLQNLHIEHCTDDFDWLLDKMLDADGIVFSTPIFEKGATGLFHTITDRFGPRMDRGNNIIGTKIAEETGGTAPDPRILKDKVISFMSVGGSDWVTRTQCDAGMLALTPMWKVIDNEVFPWALSILVEDERVARAHQIGRNIAEAAKDIEHAQYQGDAGVCPHCHSRNFHLQDGKAICCLCGLEGEIHNEGGKYSFTFPAEQLEHAHDTLSGKFIHGNDIKENTGKKIANMQTEKYKARQAAYRAFITATVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Flavoprotein
molecule keywords Cd1
publication title Discovery of an ene-reductase for initiating flavone and flavonol catabolism in gut bacteria.
pubmed doi rcsb
source organism Flavonifractor plautii
total genus 90
structure length 288
sequence length 308
ec nomenclature
pdb deposition date 2020-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...