7D8TA

Mitf bhlhlz complex with m-box dna
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
199
structure length
199
Chain Sequence
SLAKERQKKDNHNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDYIRKLQREQQRAKELENRQKKLEHACRHLLLRIQELGIEDFLKVDLRVAKVLSAERVEGSEKLLKLTLSLGDEERTVVAGIAKYYTPEELVGKKIVIVANLKPRKIFGIESQGMILAASDGENLSVIVPDRDVKEGAKLSAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords DNA (5'-D(P*GP*GP*GP*AP*CP*AP*CP*AP*TP*GP*TP*TP*AP*CP*AP*G)-3')
publication title Targeting the Lineage-specific Dynamic Microphthalmia-Associated Transcription Factor (MITF) for melanoma treatment
rcsb
source organism Homo sapiens
total genus 48
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2020-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
A PF00010 HLH Helix-loop-helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...