The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
127
|
sequence length |
542
|
structure length |
525
|
Chain Sequence |
MQLHGKMTATAKSCALDFLDFVNASPTPYHAVQNLAEHYMSHGFQYLSEKSDWQSKIEPGNSYFVTRNKSSIIAFSIGKKWKPGNGFSIIATHTDSPTLRLKPKSQKSAYGYLQVGVEKYGGGIWHTWFDRDLSLAGRVMVEEEDGRVIQYNVHIDRPLLRIPTLAIHLDPSANSSFSFNMETEFVPLIGLENELAKEETSDNGDKYHHPVLLSLLANEISKSLETTIDPSKIVDFELILGDAEKARLGGIHEEFVFSPRLDNLGMTFCASQALTKSLENNSLDNESCVRVVPSFDHEEIGSVSAQGAESTFLPAVLQRICELGKESSLFSISMVKSFLVSADMAHAMHPNYSSRYENSNTPFLNKGTVIKVNANQRYTTNSAGIVLLKKVAQLADVPIQSFVVRNDSPCGSTIGPKLAAMTGMRTLDLGNPMLSMHSCREMCGSKDFEYAVVLFSSFFQNFANLEEKIIIDEGFSVACNTCLKIIRNDSFHCTKCFDFDVCRDCYAKQAFLHPCPKPHFVLVRS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Hydrolase
|
| molecule keywords |
Aspartyl aminopeptidase 1,ZZ-type zinc finger-containing protein P35G2.11c,Maltose/maltodextrin-binding periplasmic protein
|
| publication title |
Molecular and structural mechanisms of ZZ domain-mediated cargo selection by Nbr1.
pubmed doi rcsb |
| source organism |
Schizosaccharomyces pombe (strain 972 / atcc 24843)
|
| total genus |
127
|
| structure length |
525
|
| sequence length |
542
|
| chains with identical sequence |
C, E, G, I, K, M, O, Q, S, V, X
|
| ec nomenclature |
ec
3.4.11.21: Aspartyl aminopeptidase. |
| pdb deposition date | 2020-10-28 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02127 | Peptidase_M18 | Aminopeptidase I zinc metalloprotease (M18) |
| A | PF01547 | SBP_bac_1 | Bacterial extracellular solute-binding protein |
| A | PF00569 | ZZ | Zinc finger, ZZ type |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
