7DHDA

Vibrio vulnificus wzb
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
148
structure length
148
Chain Sequence
AMGFNKILVVCVGNICRSPTGERVLQKLLPNKTVASAGIAAEKSRLIGKPADAMAIEVAKENCVDVENHQSQQLTSALCSQYDLILVMEKGHMEALTQIAPEARGKTMLFGQWIGQKDIPDPYRQSKEAFVHAYQLIDEAAQAWAKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Protein-tyrosine-phosphatase
publication title Wzb of Vibrio vulnificus represents a new group of low molecular weight protein tyrosine phosphatases with a unique insertion in the W-loop
rcsb
source organism Vibrio vulnificus
total genus 51
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2020-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...