7DI0A

Crystal structure of the rationally designed apdpbb_sym_79 protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
88
structure length
88
Chain Sequence
SSVELRVLEARPEDVGRKIVRMDKQTRARLGVSVGDYVEVKKVDRSVVARVLPARPEDVGRGIVRMDKYLRAALGVSVGDYVEVKKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords apDPBB_sym_79 protein
publication title Seven amino acid typessuffice to reconstruct the core fold of RNA polymerase
rcsb
source organism Synthetic construct
total genus 24
structure length 88
sequence length 88
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2020-11-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...