7DMNA

Crystal structure of two pericyclases catalyzing [4+2] cycloaddition
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
375
structure length
369
Chain Sequence
HMSNVTVSAFTVDKSISEEHVLPSSFIPGSGNIFPKFTSAIPKTAWELWYFDGISKDDKSSIVIGVTRNAEGLKHGGFKVQVFVIWADERTWHRDLFFPESVVSINESGVTDGIWKDATSNSSISFSCAGDLSKASLVFDVPGVVQGDMHLEALPGDTGLDTDARLGPSVYYVRPIGRASVKAQLSLYSSDATAAEQFSLGTSANGGMDRVWSPLSWPQVMTESYYLRTQVGPYAMQIMRIFPPAGSEDQPSTMARLYREGQLVCVAQHVVTRMTHDSLILSKQDNSEDVVTGGYRDKNTGYTVEFVEKGNEGQRWKFQVRHERIIWNTPTSRPGPDATGNTGFVEVLCGGTIGESYEGVGTGGQCELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Diels-Alderase fsa2
publication title Crystal Structures of Fsa2 and Phm7 Catalyzing [4 + 2] Cycloaddition Reactions with Reverse Stereoselectivities in Equisetin and Phomasetin Biosynthesis.
pubmed doi rcsb
source organism Fusarium sp. (strain fn080326)
total genus 93
structure length 369
sequence length 375
ec nomenclature ec 5.5.1.-:
pdb deposition date 2020-12-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...