7DQ13

Cryo-em structure of coxsackievirus b1 virion in complex with car at physiological temperature
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
237
structure length
237
Chain Sequence
GLPVMTTPGSTQFLTSDDFQSPSAMPQFDVTPEMQIPGRVNNLMEIAEVDSVVPVNNTEDNVSSLKAYQIPVQSNSDNGKQVFGFPLQPGANNVLNRTLLGEILNYYTHWSGSIKLTFMFCGSAMATGKFLLAYSPPGAGVPKNRKDAMLGTHVIWDVGLQSSCVLCVPWISQTHYRYVVEDEYTAAGYVTCWYQTNIVVPADVQSSCDILCFVSACNDFSVRMLKDTPFIRQDTFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structures reveal the molecular basis of receptor-initiated coxsackievirus uncoating.
pubmed doi rcsb
molecule tags Virus
molecule keywords Virion protein 1
total genus 23
structure length 237
sequence length 237
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2020-12-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...