7E97D

Oxy-deoxy intermediate of 400 kda giant hemoglobin at 58% oxygen saturation
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
145
structure length
145
Chain Sequence
ECCSRGDAEVVISEWDQVFNAAMAGSSESAIGVAIFDVFFTSSGVSPSMFPGGGDSSSAEFLAQVSRVISGADIAINSLTNRATCDSLLSHLNAQHKAISGVTGAAVTHLSEAISSVVAQVLPSAHIDAWGYCMAYIAAGIGAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxygen transport
molecule keywords Extracellular giant hemoglobin major globin subunit A1
publication title Coarse snapshots of oxygen-dissociation intermediates of a giant hemoglobin elucidated by determining the oxygen saturation in individual subunits in the crystalline state.
doi rcsb
total genus 58
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2021-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00042 Globin Globin
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...