7EF6A

Crystal structure of xanthosine monophosphate phosphatase in the unliganded state
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
233
structure length
233
Chain Sequence
DFSPINCLIFDLDDTLYPLKTGIAPAVKKNIDDFLVEKFGFSESKASSLRVELFKTYGSTLAGLRALGHDVHPDEYHSFVHGRLPYGSIEPNNKLRNLLNKIKQRKIIFTNSDKNHAVKVLKKLGLEDCFEEMICFETMNPNLFGSTTRPDEYPVVLKPSLTAMDICIRVANVDPRRTVFLDDNIHNITAGKSVGLRTILVGRAEKTKDADYAVETVTEIATAVPEIWATATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Xanthosine monophosphate phosphatase
publication title Crystal Structure of Xanthosine monophosphate phosphatase in the unliganded state
rcsb
source organism Arabidopsis thaliana
total genus 85
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2021-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...