7EGTB

The crystal structure of the c-terminal domain of t. thermophilus uvrd complexed with the n-terminal domain of uvrb
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
47
structure length
47
Chain Sequence
FRGGERVVHPRFGPGTVVAAQGDEVTVHFEGFGLKRLSLKYAELKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crucial role and mechanism of transcription-coupled DNA repair in bacteria.
pubmed doi rcsb
molecule tags Transcription
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule keywords UvrABC system protein B
total genus 7
structure length 47
sequence length 47
chains with identical sequence D
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2021-03-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...