7EJOB

Structure of erh-2 bound to tost-1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
94
structure length
88
Chain Sequence
SSHTVLLIQTSPRLDSRTWGDYESVTDALDALCKMFEDFLSVTYDVSQVYEFLDKLSDVSMMIFNRETGQYIGRTRAWIKQQVYEMMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Peptide binding protein
molecule keywords Enhancer of rudimentary homolog 2,Protein tost-1
publication title Molecular basis for PICS-mediated piRNA biogenesis and cell division.
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 24
structure length 88
sequence length 94
ec nomenclature
pdb deposition date 2021-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01133 ER Enhancer of rudimentary
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...