7EKQP

Crclpp-s2c
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
95
structure length
95
Chain Sequence
AALDITKMTPIHDRVLIRPIEEEQKTAGGILLPKAPPKANSDAHIGEVLAVGSDVTLAVAKGDMVVFQKYAMAEVEVKEGQIIFVAEKSIMGKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords ATP-dependent Clp protease proteolytic subunit
publication title The cryo-EM structure of the chloroplast Clp complex reveals an interaction with the co-chaperonin complex that inhibits Clp proteolytic activity
rcsb
total genus 5
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2021-04-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...