7EO0L

Foot and mouth disease virus o/tibet/99-bound the single chain fragmen antibody c4
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
108
structure length
108
Chain Sequence
AVLTQPSSVSASLGQRVSITCSGSSSNIGRYGATWYQQVPGSGLRTIIYGSSRRPSGVPDRFSGSKSGNTVTLTISSLQPEDEADYFCAAYDISTNAVFGSGTTLTLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords O/TIBET/99 VP1
publication title Two cross-protective antigen sites on foot-and-mouth disease virus serotype O structurally revealed by broadly neutralizing antibodies from cattle.
pubmed doi rcsb
source organism Bos taurus
total genus 14
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2021-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...