7ESBA

Fmnb complexed with atp
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
320
structure length
316
Chain Sequence
LMDQPYSKTDFLMGTVVTLKIYDKGKEDVLDKGFDRIKDLAAKITTSTSEVDKINEQAGKKPVKVSEDVYYLIQEGLKYSENSGGSFDITIGPLTSLWHIGFSDARKPSQAEIDAVLPLINYKDVKMNDKDQTVYLEKEGMELDLGAIAKGFITDETLKVFKENKVTTSIIDLGGNIYVQGNNPNGNKWNVGIQDPFSPRGSVIGKLPESNMSIVTSGIYERYLEVDGKTYHHILDPKTGYPFDNDIAGVSIVSKKSIDGDGLSTATFSKGIKGGMDYIEQFEGVDAIFISKEKKVYETSGLKGQFELTDKDFQMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords FAD:protein FMN transferase
publication title Structure of FmnB complexed with ATP
rcsb
source organism Listeria monocytogenes serotype 1/2a (strain 10403s)
total genus 98
structure length 316
sequence length 320
ec nomenclature ec 2.7.1.180: FAD:protein FMN transferase.
pdb deposition date 2021-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02424 ApbE ApbE family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...