7EV7M

Bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at a 50 k
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
43
structure length
43
Chain Sequence
ITAKPAKTPTSPKEQAIGLSVTFLSFLLPAGWVLYHLDNYKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title Structure of CO-bound fully reduced state of bovine heart cytochrome c oxidase
rcsb
total genus 14
structure length 43
sequence length 43
chains with identical sequence Z
ec nomenclature
pdb deposition date 2021-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF02285 COX8 Cytochrome oxidase c subunit VIII
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...