7EZIA

Rice l-galactose dehydrogenase (apo form)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
323
structure length
323
Chain Sequence
AHHHHHHMELRELGATGLRVSPVGFGASPLGHVFGDVPRDVARAAVRRALDLGINFFDTSPYYGGTVSESVLGDCLRAAGVPRDRFVVATKCGRYREGFDFSAARVTRSVDESLARLGLDYVDILHCHDIEFTDLDQIVNETIPVLQKIKESGKARFIGITGLPLSIYTYVLDQVPPGSVDVILSYCHYGINDTALVDLLPYLKSKGVGVISASPLAMGLLTDNGPPEWHPAPKELKLACRAAADHCKKKGKNITKLAMQYSLMNNEISTVLVGMNSPEQVEENVAAAIELSTSGIDKELLHEVEAILEPVKNMTWSSGIEQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-galactose dehydrogenase
publication title Crystal structure of rice L-galactose dehydrogenase
rcsb
source organism Oryza sativa subsp. japonica
total genus 111
structure length 323
sequence length 323
ec nomenclature
pdb deposition date 2021-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...