7JQM1Z

Crystal structure of the thermus thermophilus 70s ribosome in complex with bac7-002, mrna, and deacylated p-site trna at 3.05a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
154
Chain Sequence
MEYRLKAYYREGEKPSALRRAGKLPGVMYNRHLNRKVYVDLVEFDKVFRQASIHHVIVLELPDGQSLPTLVRQVNLDKRRRRPEHVDFFVLSDEPVEMYVPLRFVEIHRDILVKVSPRNIPEFIEVDVIGDSLHASDLKLPPGVELAVSPEETI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptide inhibitors of bacterial protein synthesis with broad spectrum and SbmA-independent bactericidal activity against clinical pathogens.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 24
structure length 154
sequence length 171
chains with identical sequence 2Z
ec nomenclature
pdb deposition date 2020-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1Z PF01386 Ribosomal_L25p Ribosomal L25p family
1Z PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...