7JTFA

Structure of hepatitis c virus envelope glycoprotein e2 core from genotype 6a bound to broadly neutralizing antibody rm2-01
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
222
structure length
211
Chain Sequence
LVQSGAEVKKPGASVKLSCKASGFTFRIYAISWVRQAPGQGLEWMEIVPLGGITNYAQNFQGRAAITADTSINTAYMELSSLRSDDTAVYYCARVRTALVGPREGIFDFWGQGVLVTVSSASTKGPSVFPLAPALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords RM2-01 Fab heavy chain
publication title HCV Env immunization elicits a rapid VH1-69-like broadly neutralizing antibody response in rhesus macaques
rcsb
source organism Macaca mulatta
total genus 27
structure length 211
sequence length 222
chains with identical sequence C
ec nomenclature
pdb deposition date 2020-08-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...