7JVEA

Crystal structure of salmonella enterica typhimurium bcfh
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
253
structure length
253
Chain Sequence
DSAPTSQIGPTAEAYIVSHPDKVGEVVATYLAEHPEFLVAASETLHQRQQIAQQQAYVQLALQYRAELLSSSSPSVGPNEAKAAVVMFFDYQCSWCSKMAPVVENLIKANPDTRFIFKEFPIFSSRWPVSGLAARVGEQVWLTQGGAKYLDWHNALYATGKVEGALTEHDVYTLAQHYLTPTQLAAVKEAQSSGAVHDALLTNQALAQHMDFSGTPAFVVMPQTQDGDVKRVTVIPGSTTQDMLQMAIQKAKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DsbA family protein
publication title Salmonella enterica BcfH Is a Trimeric Thioredoxin-Like Bifunctional Enzyme with Both Thiol Oxidase and Disulfide Isomerase Activities.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 95
structure length 253
sequence length 253
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2020-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...