7K1UA

Crystal structure of srtb-anchored collagen-binding adhesin fragment (residues 206-565) from clostridioides difficile strain 630
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
270
structure length
253
Chain Sequence
VSDTPKVTDTLIELFKIDMETQKDNPQGNASLAGAEFTWKYYAGFYNKENLPAEATRTWVTKTIAETDSDGTTHYITKLADAYKVSGDSFYMQDGKAVLPLGTLTVEETKAPNGYLLDGAYMQAGDKSEQIKGLYVTQITEDGDLAVLSGSNQFSVSDKVIRGGVKIQKRPQGSATLKDTAFDIISLNDNVVLVEGKLYKKNEVVKTIHTDIEGVASTSADLLPYGKFRIVESEAKPIDFAITENGKIVDLTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Collagen-binding Adhesin
publication title Crystal Structure of SrtB-anchored Collagen-binding Adhesin Fragment (residues 206-565) from Clostridioides difficile strain 630
rcsb
source organism Clostridioides difficile
total genus 48
structure length 253
sequence length 270
ec nomenclature
pdb deposition date 2020-09-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...