7K22L1

Murine polyomavirus pentavalent capsomer with 8a7h5 fab, subparticle reconstruction
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
98
Chain Sequence
DIVMTQSPTSMSISVGDRVTMNCRASQNVYSNVDWYQQKTGQSPKLVIYKASNRYTGVPDRFTGSGSGTYFTLTITNIQTEDLAVYYCLQSNAFPFTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords 8A7H5 Fab light chain
publication title Antibody escape by polyomavirus capsid mutation facilitates neurovirulence.
pubmed doi rcsb
source organism Mus musculus polyomavirus 1
total genus 15
structure length 98
sequence length 98
chains with identical sequence L2, L3, L4, L5
ec nomenclature
pdb deposition date 2020-09-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...