7K7IK

Density-fitted model structure of antibody variable domains of tytx4 in complex with pltb pentamer of typhoid toxin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
108
structure length
108
Chain Sequence
DILLTQSPSILSVSPGERVSFSCRASQSIGTSIHWYQQKPNGSPRLLIQYASQSISGIPSRFSGSGSGTDFTLTINSVESEDIADYYCQHTNGWPYTFGWGDHAGNKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Putative pertussis-like toxin subunit
publication title The structural basis of Salmonella A 2 B 5 toxin neutralization by antibodies targeting the glycan-receptor binding subunits.
pubmed doi rcsb
source organism Salmonella typhi
total genus 15
structure length 108
sequence length 108
chains with identical sequence L, N, Q, Y
ec nomenclature
pdb deposition date 2020-09-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...