7KCRH

Cryo-em structure of zika virus in complex with e protein cross-linking human monoclonal antibody adi30056
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
121
structure length
121
Chain Sequence
EVQLLESGGGVVQPGGSLRLSCTASGFTFRNFGIHWVRQAPGKRLEWVAFIRYDGRNKYYADSVKGRFISSRDNSKNMVYLDMKSLRPEDTAIYHCAADGEETSPGSFDYWGQGTLVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus/immune system
molecule keywords ADI30056 Fab heavy chain variable region
publication title Structural Basis of Zika Virus Specific Neutralization in Subsequent Flavivirus Infections.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2020-10-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...