7KESA

Crystal structure of meta-aac0038, an environmental aminoglycoside resistance enzyme, mutant h168a in complex with apramycin and coa
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
260
structure length
260
Chain Sequence
SRVSTRSSLAEDLRAIGLADGDAVLVHAALRKVGKIVGGPDDILDAMRDVIGPAGTVLGYADWQLEDEIRDDPAMREHIPAFDPLRSRSIRDNGFWPELIRTTPGALRSASPGASMAAIGGEAEWFTADHALDYGYGPRSPLGKLVEAKGKVLMLGAPLDTMTLLAHAEHLADFPNKRILRYEAPILVDGEKVWRWFEEFDTSDPPDGLADDYFAGIVEEFLATGRGKRGKIGEASSVLVPADEIVAFAVDWLERWGRTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/antibiotic
molecule keywords Aminoglycoside N(3)-acetyltransferase
publication title Crystal structure of meta-AAC0038, an environmental aminoglycoside resistance enzyme, mutant H168A in complex with apramycin and CoA
rcsb
source organism Uncultured bacterium
total genus 80
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature ec 2.3.1.81: Aminoglycoside N(3)-acetyltransferase.
pdb deposition date 2020-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02522 Antibiotic_NAT Aminoglycoside 3-N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...