7KEWG

Bundibugyo virus gp (mucin deleted) bound to antibody fab bdbv-43
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
122
structure length
122
Chain Sequence
b'QVQLVQSGAEVKKPGSSVKVSCRASGDSFSRKYGISWVRQAPGQGFEWMGTIMPIVGLTTSAQKFQGRVTITADKSTSTAHMELNSLTSEDTAIYYCARDEIIGARPHWFDSWGQGTLVTVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spike glycoprotein 1
publication title Convergence of a common solution for broad ebolavirus neutralization by glycan cap-directed human antibodies.
pubmed doi rcsb
source organism Bundibugyo ebolavirus
molecule tags Viral protein/immune system
total genus 27
structure length 122
sequence length 122
chains with identical sequence H, I
ec nomenclature
pdb deposition date 2020-10-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...