7KFTA

Partial cas6-rt-cas1--cas2 complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
90
Chain Sequence
b'MKHYLICFDVQHDKTRAKLSRLLEKYGPRVQGSVFEVSFKTPDRKRQLEYKIHQIIKQSNTEENNIRFYNLNKDTIKHSHDINGNPIAQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cas2
molecule tags Hydrolase
source organism Thiomicrospira sp.
publication title Structural coordination between active sites of a Cas6-reverse transcriptase-Cas1-Cas2 CRISPR integrase complex
rcsb
total genus 18
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2020-10-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...