7KLNA1

Myoviridae phage xm1 neck region (12-fold)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
369
structure length
361
Chain Sequence
DVLSGLINRRNSMARNRVSHRYLSDEEMRVMYKAGLMSKIIRLKAGYALNDTLKFESTQDQEIYKKRLSKHVKNATKFMLGFGRGVIVVFKNGDDLSKPLERGVDPKLLKIRVFSGDIAKGNNPDNDLRSERYYKPKNYTIKGHTIHWTRVVDFTYYMPSENELPDYYYGGMSESELIYEQFINDSVVQRASGSIIEKASTFVYKIKGYKQLIQAKKEEDIIKYVSTCEDGRSIYGGLITDADDEVSTLTQSLTDLDKVDNVTLRRIAMVTGLGMTVLIGEQASGLNASGEKERQGFQDTIENLQSDYLEDPLNRLAEIFQLGFIEFKDRVEYDKKAVDVAKVLWELGEDYGAYLKDKDVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Portal protein
publication title Near-atomic-resolution structure of Vibrio phage XM1 possessing a simple contractile DNA injection machine
rcsb
total genus 74
structure length 361
sequence length 369
chains with identical sequence B1, C1, D1, E1, F1, G1, H1, I1, J1, K1, L1
ec nomenclature
pdb deposition date 2020-10-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...