7KV5AAA

Surface glycan-binding protein b from bacteroides fluxus
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
253
structure length
246
Chain Sequence
SQLSFTATPGSNPNVVTLKNTSSLKVTWDLGNGVTAKGEEVVASYPFANTYTIAMTAYSTTITQTITIANNDESQIEPKAIILAGGLTGSKTWVFDRAHDGHFGVGPGAGNPDYNGTPSWWSCPAEGKAECALYENEFSFHLDGGYNMTWVNKGKIYTNGAGKDKLPGVATVPGAGDFDVEYIPKEAYTFTVDGDKLKLSDDAFFGHFAGTSTYTIKTLNENELYLECSSAVESGNGWWYRFVPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords PKD domain protein
publication title Distinct protein architectures mediate species-specific beta-glucan binding and metabolism in the human gut microbiota
rcsb
source organism Bacteroides fluxus yit 12057
total genus 50
structure length 246
sequence length 253
ec nomenclature
pdb deposition date 2020-11-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...