7KVWA

Non-ribosomal didomain (holo-pcp-c) acceptor bound state
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
519
structure length
513
Chain Sequence
VTAYEEIVCQVFAAVLDRSDVTADADFFALGGHSLLSLRVVARLRALLGVDVGVRDLFEAPTPAALAARLRPAVTRRGPDAPPVLSHFQRRLWLIEQVYQTRGAYNVPLAVHVSDRLDLDVLRAAVRDLVARHEVLRTLVRSSDDGPDPVLLAPEDAAVDVAEVQAAGPVADLLAELTAQPFDLATQIPLRVRMITGEQVDGCVLLLVCHHIAADEWSFAPLLRDLDTAYRARAAGRAPDWEPLPAQYSDYAATLHDWLGEATDPASPLRRQLDYWQHALQDLPDELDLPTDRPRPATASHRGGLARAELPPELVEAVRRLAAQHGVTVFMVVQAAVAVLLHRLGAGDDIPLGSPVADRADEAVHDTVGFFLNTLVLRVNLSGNPTFADLLDRVRAVDLEAFARADAPFDAVVDTVKPPRAVSRHPLFQTMVSYQRRPSDVDRLFGAATRLVEVPLDTAKFDLEFAFIEDGHGGAHIALNYAADLFDHDSAEQLVARLRTVLEHACADPCRPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Biosynthetic protein
molecule keywords PCP-C didomain
publication title Understanding condensation domain selectivity in non-ribosomal peptide synthesis: structural characterization of the acceptor bound state
rcsb
source organism Thermobifida fusca
total genus 163
structure length 513
sequence length 519
chains with identical sequence B
ec nomenclature
pdb deposition date 2020-11-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...