7L0OA

Streptococcus gordonii c123 domain(s)-structural and functional analysis
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
493
structure length
479
Chain Sequence
HYSSLLAQPQINKEIKNEDGVDIDRTLVAKQSIVKFELKTEALTAGRPKTTSFVLVDPLPTGYKFDLDATKAASTGFDTTYDEASHTVTFKATDETLATYNADLTKPVETLHPTVVGRVLNDGATYTNNFTLTVNDAYGIKSNVVRVTTPGKPNDPDNPNNNYIKPTKVNKNKEGLNIDGKEVLAGSTNYYELTWDLDQYKGDKSSKEAIQNGFYYVDDYPEEALDVRPDLVKVADEKGNQVSGVSVQQYDSLEAAPKKVQDLLKKANITVKGAFQLFSADNPEEFYKQYVATGTSLVITDPMTVKSEFGKTGGKYENKAYQIDFGNGYATEVVVNNVPKITPKKDVTVQLYQTFNYRLIGGLIPQNHSEELEDYSFVDDYDQAGDQYTGNYKTFSSLNLTMKDGSVIKAGTDLTSQTTAETDATNGIVTVRFKEDFLQKISLDSPFQAETYLQMRRIAIGTFENTYVNTVNKVAYASA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Agglutinin receptor
publication title Structural and functional analysis of the C-terminal region of Streptococcus gordonii SspB.
pubmed doi rcsb
source organism Streptococcus gordonii
total genus 116
structure length 479
sequence length 493
chains with identical sequence B
ec nomenclature
pdb deposition date 2020-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17998 AgI_II_C2 Cell surface antigen I/II C2 terminal domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...