7LB5A

Pyridoxal 5'-phosphate synthase-like subunit pdx1.2 (arabidopsis thaliana)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
260
structure length
260
Chain Sequence
PFSVKVGLAQVLRGGAIVEVSSVNQAKLAESAGACSVIVSDPVRSRGGVRRMPDPVLIKEVKRAVSVPVMARARVGHFVEAQILESLAVDYIDESEIISVADDDHFINKHNFRSPFICGCRDTGEALRRIREGAAMIRIQGDLTATGNIAETVKNVRSLMGEVRVLNNMDDDEVFTFAKKISAPYDLVAQTKQMGRVPVVQFASGGITTPADAALMMQLGCDGVFVGSEVFDGPDPFKKLRSIVQAVQHYNDPHVLAEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords Pyridoxal 5'-phosphate synthase-like subunit PDX1.2
publication title Tunable Heteroassembly of a Plant Pseudoenzyme-Enzyme Complex.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 77
structure length 260
sequence length 260
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2021-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01680 SOR_SNZ SOR/SNZ family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...