7LL1E

Cryo-em structure of bg505 ds-sosip in complex with glycan276-dependent broadly neutralizing antibody vrc40.01 fab
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
229
structure length
229
Chain Sequence
QVQLIQSGPQFKTPGASVTVSCKASGYIFTDYLIHWVRLVPGKGLEWLGRINTNAGLMYLSHKFEGRLILRRVVDWRTPSLGTVNMELRNVRSDDSAIYFCGRVVDGFNAAGPLEFWGQGSPVIVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords Envelope glycoprotein gp120
publication title Structural Basis of Glycan276-Dependent Recognition of HIV-1 Envelope by Broadly Neutralizing Antibodies
rcsb
source organism Human immunodeficiency virus 1
total genus 46
structure length 229
sequence length 229
chains with identical sequence H, J
ec nomenclature
pdb deposition date 2021-02-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...