7LOHA

Structure of the hiv-1 gp41 transmembrane domain and cytoplasmic tail
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
180
structure length
158
Chain Sequence
NWLWYIRIFIIIVGSLIGLRIVFAVLSLVNRVRQGYSPLSERDRDRSIRLVNGSLALIWDDLRSLSLFSYHRLRDLLLIVTRIVELLGRRGWEALKYWWNLLQYWSQELKNSAVSLLNATAIAVGEGTDRVIEVVQGASRAIRHIPRRIRQGLERILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Transmembrane protein gp41
publication title NMR Model of the Entire Membrane-Interacting Region of the HIV-1 Fusion Protein and Its Perturbation of Membrane Morphology
doi rcsb
source organism Human immunodeficiency virus 1
total genus 50
structure length 158
sequence length 180
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2021-02-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...