7LSGC

Crystal structure of the human neutralizing antibody fab fragment t025 bound to tbev ediii (siberian subtype)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
94
structure length
94
Chain Sequence
b'TYTMCDKTKFAWKRTPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGFPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords T025 Fab Heavy Chain
publication title Broad and Potent Neutralizing Human Antibodies to Tick-borne Flaviviruses Protect Against and Treat Infection in Mice
rcsb
source organism Homo sapiens
molecule tags Immune system/viral protein
total genus 16
structure length 94
sequence length 94
ec nomenclature ec 3.4.21.91: Flavivirin.
pdb deposition date 2021-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...