7LUVB

Cryo-em structure of the yeast tho-sub2 complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
220
structure length
189
Chain Sequence
TYFESLCEEEQSLQESQTHLLNILDILSVLAKLPDLHRELINSSIRLRYDKYQTREAQLLEDTPKSISEYYSTFEHLNRDTLRYINLLKRLSVDLAKQVEVSDPSVTVYEMDKWVPSEKLQGILEQYCIRGVDAQIKNYLDQIKMARAKFGLENKYSLKERLSTLTKELNHWRKEWDDIEMLMFGDDAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords THO complex subunit HPR1
publication title Cryo-EM structure of the yeast TREX complex and coordination with the SR-like protein Gbp2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 58
structure length 189
sequence length 220
ec nomenclature
pdb deposition date 2021-02-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...