7MD3H

The f1 region of apoptolidin-bound saccharomyces cerevisiae atp synthase
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
53
structure length
48
Chain Sequence
SYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYASEPTPITK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ATP synthase subunit alpha
publication title A Family of Glycosylated Macrolides Selectively Target Energetic Vulnerabilities in Leukemia
doi rcsb
total genus 9
structure length 48
sequence length 53
ec nomenclature
pdb deposition date 2021-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF04627 ATP-synt_Eps Mitochondrial ATP synthase epsilon chain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...