7MD71U

Crystal structure of the thermus thermophilus 70s ribosome in complex with triphenylphosphonium analog of chloramphenicol cam-c4-tpp and protein y (yfia) at 2.80a resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
116
structure length
116
Chain Sequence
b'PRAKTGVVRRRKHKKILKLAKGYWGLRSKSFRKARETLFAAGNYAYAHRKRRKRDFRRLWIVRINAACRQHGLNYSTFIHGLKKAGIEVDRKNLADLAVREPQVFAELVERAKAAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Binding and Action of Triphenylphosphonium Analog of Chloramphenicol upon the Bacterial Ribosome
doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Ribosome
total genus 41
structure length 116
sequence length 116
chains with identical sequence 2U
ec nomenclature
pdb deposition date 2021-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1U PF00453 Ribosomal_L20 Ribosomal protein L20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...