7MFQA

Crystal structure of the l136 aminotransferase from acanthamoeba polyphaga mimivirus in complex with the tdp-viosamine external aldimine
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
351
structure length
351
Chain Sequence
b'GLEKLTWVSEKKPDWSNVQKLIAACEATNQYTNIGPIISQLESFIRDSFLIEESKAVIVTSNGTSALHALVGGINRQLGRELKFVTQSFTFPSSNQGPLKDSIIVDIDEDGGLDLNAVKNIEYDGIIVTNIHGNVVDINKYVDFCMNHNKLLIFDNAATGYTFYLGKNSCNYGHASIISFHHTAPFGFGEGGCIIVDRLYENNIRIGLNFGLDNSLGEKSQYSNQASNYRMCDLNAAFILSYLQNNYKKIINRHSEIYEIYKNNLPKRFKLFPNHSKKNPVCSSICLLFDKPFRLDKIPFLSRKYYKPLDLSSPVSLDFYQRILCIPCNIDLTDRQIYEIIGVLNEFADKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L136 aminotransferase
publication title Characterization of an aminotransferase from Acanthamoeba polyphaga mimivirus
rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
total genus 132
structure length 351
sequence length 351
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2021-04-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...